Reviews of The Lord’s Empire by Shen Tianyi - Webnovel

Not your preferred language? Here to Choose your language.

768Reviews

4.11

  • Translation Quality
  • Stability of Updates
  • Story Development
  • Character Design
  • World Background

Share your thoughts with others

Write a review
Withered_Oblivion
Really wished this Novel would continue. not sure what happen to the author but I love nooks like this. e.g. the world online and rotssg. plz reply if uk books like these!
2yr
View 0 Replies
EternalDragonO0
Good Read so far. ............................................................................................................................................................................
3yr
View 0 Replies
DaoistjrTHui
¿Cuándo se actualiza esto? rapidoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
3yr
View 0 Replies
CrimsonLaw
[img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp][img=exp]
3yr
View 0 Replies
Ayenuwa_Ayodeji
The best I've read.[img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update]
3yr
View 1 Replies
denhaanxander
I found this Garbage With a shit lot of racism If you arent chinese as only china Has a good enough history and is old enough and is better than every other country with a rapist mc who at some point is fucking someone nearly every 10 chapters and way too nationalistic with a bullcrap amount of misinformation about other countries and the rape And kidnapping is just too much.
3yr
View 3 Replies
Cloudelka
The translator is still active on webnovel, but seems to have jumped between different novel to translate and then abandoned them without any information. Don't spend money on an abandoned translation.
3yr
View 0 Replies
ThePreceptor
This is the work I like most , from game elements to cultivation , harem, kingdom building, loyal subordinates, etc. Much love to the writer please kindly complete the work
3yr
View 4 Replies
HanJuiMe
stil no update lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol lol
img
3yr
View 0 Replies
HintermeierChristi
At first i liked this story better the The World Online because in the beginning there where not the overflow with the description of historical persons and the flaw in the forced technical development. But similar to The World Online there is the exaggeration with distances, the time needed to travel them and the dimension for example the size of some monster. But further in the story this author use the discreption of the next batch of women to rape for filler chapter. At the beginning you can have sympathy with the mc because of his poor start and his struggle to overcome his handicaps. But further down the mc is more degraded as all bad historical persons mentioned in this book together. He rambles often about his bottom line only to lower it further in the story. I think if his mother wasn´t dead allready he would included her also in his harem. So a good building an empire story developed in a rather bad stringing together of the next batch of women to be raped by the mc.
3yr
View 0 Replies
God_slayer09
I've read this novel multiple times and first started reading it a year ago and liked it so much that I caught up with the latest chapters but its been so long since any updates that it sucks hope its updated soon and not forgotten.
3yr
View 0 Replies
DaoistNAU35W
This book is amazing there are a few translation errors but overall everything else keeps me engrossed in this book and in the wonderful characters.
3yr
View 0 Replies
DaoistjxZyPT
Is the best, more cap please !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
3yr
View 0 Replies
obolisk_3349_3349
awesome novel ........................................................................................................................................
3yr
View 0 Replies
DaoistAhDai
I really loved this story and it was one of the stories where I read a lot of chapters but everything just went downhill because of the r*PE and the story never really just progressed, it worsened...
3yr
View 0 Replies
mugi19
LV 14 Badge

mugi19

Honestly. if hes gonna be evil stop acting like hes a good guy. so tired of him genuinely raping and abusing women and killing children then acting righteous.
3yr
View 3 Replies
Your_God_Menace
honestly this is my second time reading this book but I stopped during the early chapters because I had to switch phones. but this book and "Legendary Mechanic" are my 2 sources of inspiration due to the characters and the plot. They make me want to try and write my own book which will be challenging but I'm willing to try!
3yr
View 0 Replies
TheBlindIdiot
When is this getting updated 🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔😊😊😊😊😊😊🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔🤔
3yr
View 0 Replies
Storio
[img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update][img=update]
3yr
View 0 Replies
Mauro_Reges_6177
Quero sabe quando vão voltar a tradução dos capítulos restante 🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞
3yr
View 0 Replies
ConteHasNoIdea
This novel had soo much potential like this novel was going in the best direction possible. Everything was perfect. The IRL part of this novel was perfect. Untill around chapter 800+ THE MC aquires a technique from the dragon which is where you have near infinite Libido but when you have *** with a female she would go crazy and it would boost the MC power. It also made every female attracted which is why they banned it. Anyway there is about 50 chapters in a row about smut like after those 50 chapters it still gets mentioned twice every 3 chapters. Anyway the novel almost got ruined but it picked itself back up again. But then the Curse the god damm curse. This made him going around collecting women to be his demon spirits this caused him to almost have a all out war with a guy who had very high cultivation. BUT THEN IT GOT EVEN WORSE the mc can defeat people 3 major realms below him. DID YOU HEAR THAT 3 REALMS. BUT then it got soo bad that i gave up on it. I saw some reviews about the novel being super slow paced which i thought was true to a certain extent but then there was like 100 of them so i searched up his territory ranking and at chapter 1400 ish he was a barony level 2 but all the worlds surrounding him (Inner domain) were wanting to bootlick as they thought he would be a royal kingdom which was correct but IT TOOK 1100 CHAPTERS TO DO IT like it happened around chapter 2400 anyway at that moment i decided FML im dropping this abomination of a novel. Oh Yeah F*** the origin mark and bloodlines. And it was going soo god damm well around chapter 700
3yr
View 1 Replies
roderick12345
when is this going to update??????????                                                                                                                                       
3yr
View 0 Replies
Evelcior
Was good until chapter 300 -after that it gets a lil boring still good dffkjgggggggggvyfsddfdddffffffghhdgvvvnmkklloutdsssssddddddddddddfffd
Reveal Spoiler
3yr
View 0 Replies
Densort
LV 10 Badge

Densort

Alguien sabe si despues del final (cap1622) existe una continuacion? enserio porque 2 de las novelas PA que mas me han gustado el final es el mismo es decir te das cuenta de que todo el puto libro practicamente es como un prologo de lo que seria el libro ho esa es la sensacion que me dejaron Spoiler: En esta acaba tras el ataque de los exploradores de Armonia y ya ni siquiera sabes lo que pasa con el prota y sus mujeres despues de la explosion de Marte, y en la otra era lo mismo pero acaba cuando salen con un barco de la zona de cuarentena hacia Australia y despues de pegarse en la costa con los militares se desperdigan todos. Enserio cuando llego a estos finales es como una patada en los huevos, entiendo si es porque pretendes seguir con la historia de ese mundo pero si finalizas es porque no seguiras i dejar una novela con este tipo de final es desgarrador ahora para quejarme de los votos porque pollas tengo que poner estrellitas a la calidad y estabilidad si no esta traducido al idioma que leo y tampoco leo en este sitio yo solo queria comentar por aburrimiento
3yr
View 0 Replies
Senih_Dogan
We are waiting when are you giong to post more chapter it has been 6 mOths siNce the Last one. Please
3yr
View 0 Replies
Daoist1rvBov
Hi , This is Tynan, I am an editor from another platform that focuses on adventurous Genre Fictions. After reading your “The Lord’s Empire”, I decided to contact you and if possible, to extend you an invitation on distributing your works. However, there are so little I can talk about it here. If you were interested, please contact me via tynan@ringdomstory.com , then I should take opportunity to discuss it with you in detail. It was a great pleasure to meet your story. Sincerely Tynan
3yr
View 0 Replies
Xuen
LV 1 Badge

Xuen

Don't read, this sucks. This author just drags the story as much as possible. Chapter 296-303, 7 chapters just to show how powerful the MC is, how every powerhouses uses their power to restrict MC, and all of them come one by one. For example powerhouse A stops the MC, then MC breaks free, then powerhouse B comes to stop MC, then MC breaks free again, then powerhouse C,D, etc.. The author tried to portray MC as a cold-blooded, smart person but chooses to write the story line in a foolish direction. Makes the MC kill a god when he's just a small peasant which backlashes and triggers a "bad-fortune" phenomenon. Just fking stupid. It drags a cliffhanger for over 10 chapters, and in those chapters author fills them with thousands of words which are irrelevant to the story, just a bunch of desciptions. It makes you read, read and read, then end it with MC losing everything due to his stupidity and his foolish actions. Call him a king? More like a fool. Just Fk this novel. Don't read. Fk this novel. I read this in Chinese version, but Qidian doesn't allow reviews, so i'm leaving this review here. On Qidian website, there's literally no one reading this anymore, the author continue writing because there's people reading on Webnovel, so i'm here to warn everyone that would like to read this novel to leave and give up the idea of reading this shit. Quit before you rage and want to kill this author like me. If i see this author im going to fk him up for wasting my time. Fk his life.
3yr
View 0 Replies
khansubhan070
You know the story isn't good, when more than 500+ reviews, talk about the Mc being shallow idiot, with heavenly thick plot armor, and Is a rapist all along the story, along with the immensely misinformed author who doesn't know ****, about world history and goes on and on to brag about some ****ty Qing or whatever Chinese dynasty
3yr
View 1 Replies
silentsilent17
this novel has the same vibes with "hail the king"...where the mc conquer the 2 worlds(real world and game world) that somehow connected to each other. but still with decent mc and storyline that still enjoyable every chapter
3yr
View 0 Replies
Mazen_Basyouni
Good ❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️
3yr
View 0 Replies