Reviews of The Lord’s Empire

724 Reviews

4.12

  • Translation Quality
  • Stability of Updates
  • Story Development
  • Character Design
  • World Background

Share your thoughts with others

Write a review
Mauro_Reges_6177
Quero sabe quando vão voltar a tradução dos capítulos restante 🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞🤞
7d
view 0 replies
Aaronchif
This novel had soo much potential like this novel was going in the best direction possible. Everything was perfect. The IRL part of this novel was perfect. Untill around chapter 800+ THE MC aquires a technique from the dragon which is where you have near infinite Libido but when you have *** with a female she would go crazy and it would boost the MC power. It also made every female attracted which is why they banned it. Anyway there is about 50 chapters in a row about smut like after those 50 chapters it still gets mentioned twice every 3 chapters. Anyway the novel almost got ruined but it picked itself back up again. But then the Curse the god damm curse. This made him going around collecting women to be his demon spirits this caused him to almost have a all out war with a guy who had very high cultivation. BUT THEN IT GOT EVEN WORSE the mc can defeat people 3 major realms below him. DID YOU HEAR THAT 3 REALMS. BUT then it got soo bad that i gave up on it. I saw some reviews about the novel being super slow paced which i thought was true to a certain extent but then there was like 100 of them so i searched up his territory ranking and at chapter 1400 ish he was a barony level 2 but all the worlds surrounding him (Inner domain) were wanting to bootlick as they thought he would be a royal kingdom which was correct but IT TOOK 1100 CHAPTERS TO DO IT like it happened around chapter 2400 anyway at that moment i decided FML im dropping this abomination of a novel. Oh Yeah F*** the origin mark and bloodlines. And it was going soo god damm well around chapter 700
22d
view 1 replies
roderick2345
when is this going to update??????????                                                                                                                                       
1mth
view 0 replies
eragon
Was good until chapter 300 -after that it gets a lil boring still good dffkjgggggggggvyfsddfdddffffffghhdgvvvnmkklloutdsssssddddddddddddfffd
Reveal Spoiler
1mth
view 0 replies
Densort
Alguien sabe si despues del final (cap1622) existe una continuacion? enserio porque 2 de las novelas PA que mas me han gustado el final es el mismo es decir te das cuenta de que todo el puto libro practicamente es como un prologo de lo que seria el libro ho esa es la sensacion que me dejaron Spoiler: En esta acaba tras el ataque de los exploradores de Armonia y ya ni siquiera sabes lo que pasa con el prota y sus mujeres despues de la explosion de Marte, y en la otra era lo mismo pero acaba cuando salen con un barco de la zona de cuarentena hacia Australia y despues de pegarse en la costa con los militares se desperdigan todos. Enserio cuando llego a estos finales es como una patada en los huevos, entiendo si es porque pretendes seguir con la historia de ese mundo pero si finalizas es porque no seguiras i dejar una novela con este tipo de final es desgarrador ahora para quejarme de los votos porque pollas tengo que poner estrellitas a la calidad y estabilidad si no esta traducido al idioma que leo y tampoco leo en este sitio yo solo queria comentar por aburrimiento
1mth
view 0 replies
Senih_Dogan
We are waiting when are you giong to post more chapter it has been 6 mOths siNce the Last one. Please
1mth
view 0 replies
Daoist1rvBov
Hi , This is Tynan, I am an editor from another platform that focuses on adventurous Genre Fictions. After reading your “The Lord’s Empire”, I decided to contact you and if possible, to extend you an invitation on distributing your works. However, there are so little I can talk about it here. If you were interested, please contact me via tynan@ringdomstory.com , then I should take opportunity to discuss it with you in detail. It was a great pleasure to meet your story. Sincerely Tynan
1mth
view 0 replies
Xuen
LV 1

Xuen

Don't read, this sucks. This author just drags the story as much as possible. Chapter 296-303, 7 chapters just to show how powerful the MC is, how every powerhouses uses their power to restrict MC, and all of them come one by one. For example powerhouse A stops the MC, then MC breaks free, then powerhouse B comes to stop MC, then MC breaks free again, then powerhouse C,D, etc.. The author tried to portray MC as a cold-blooded, smart person but chooses to write the story line in a foolish direction. Makes the MC kill a god when he's just a small peasant which backlashes and triggers a "bad-fortune" phenomenon. Just fking stupid. It drags a cliffhanger for over 10 chapters, and in those chapters author fills them with thousands of words which are irrelevant to the story, just a bunch of desciptions. It makes you read, read and read, then end it with MC losing everything due to his stupidity and his foolish actions. Call him a king? More like a fool. Just Fk this novel. Don't read. Fk this novel. I read this in Chinese version, but Qidian doesn't allow reviews, so i'm leaving this review here. On Qidian website, there's literally no one reading this anymore, the author continue writing because there's people reading on Webnovel, so i'm here to warn everyone that would like to read this novel to leave and give up the idea of reading this shit. Quit before you rage and want to kill this author like me. If i see this author im going to fk him up for wasting my time. Fk his life.
1mth
view 0 replies
khansubhan070
You know the story isn't good, when more than 500+ reviews, talk about the Mc being shallow idiot, with heavenly thick plot armor, and Is a rapist all along the story, along with the immensely misinformed author who doesn't know ****, about world history and goes on and on to brag about some ****ty Qing or whatever Chinese dynasty
1mth
view 1 replies
silentsilent17
this novel has the same vibes with "hail the king"...where the mc conquer the 2 worlds(real world and game world) that somehow connected to each other. but still with decent mc and storyline that still enjoyable every chapter
1mth
view 0 replies
Mazen_Basyouni
Good ❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️
1mth
view 0 replies
8Eight
Please for the love of God save your money Aight let's go. What we have here is actually a decent premise, where atleast at the start seem somewhat intelligent The first 700ish chapters are fine however As the chapters go on empire building start to take more and more of a backseat, with minimal effort put into the few segments there are And you think to yourself, it will get better. Well so though I I'm sitting here at chapter 1671 reading copy paste chapters which are purely Word count filler. I'd rather read some random broken English system novel than this. I cannot stress this enough, please don't waste your money
Reveal Spoiler
1mth
view 0 replies
ronel_franko
a very good story well made. and interesting with twist and turns. i like this novel a lot. don't understand why they stop translated the novel. i hope they will continue soon. :(
1mth
view 0 replies
Noell_Imc
apakah tidak bisa di translate Indonesia?🤔🤔🤔 saya awal baca di google, tapi Sekang eror😑 baca disini tapi ga bisa di terjemahan huhuhuu😔😓😓😂
Reveal Spoiler
1mth
view 0 replies
frostqilin
wht should i say i have read till chapter 1260 n all i can say is MC is an masochist always getting beaten during battle n then only using all his powerat the end like in DBZ. its already been 6 or 7 years till then n still the MC doesnt know how to fight i mean he is totally reliant in his bloodline n weapon quality n later on his instincts.i mean he got so many good swords and he doesnt even try to learn the way to use sword its like as people say people don't treasure things which they got easily or something like tht.
2mth
view 1 replies
mookalya
I liked this novel a lot its a fun mix up og xianxia apocalypse and a base building game. im not done with it Yet but want to see where it goes
2mth
view 0 replies
MR_BackStabber
This author Is trying to offend as many countries as possible like with Vietnam and india and mc is a fking raping people in the novel especially this content is quite sensitive because all readers are not only from china but all over the world . making villains of other countries is agreeable but raping people he isn't even giving face to others
2mth
view 0 replies
adam_8654
Does anyone know what happened to translation it kinda stopped was it because of quarantine or did the translator just drop it overall
2mth
view 1 replies
Phenomenal1ne
Love the book, even though the MC goes from the good to the bad guy, it makes the book amazing. The MC is totally amazing even him been licentious and all that.We need more updates plssssssss🤗
2mth
view 0 replies
Goddey1
Where are the updates 😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩😩
2mth
view 0 replies
Trailblazer619
The light novel started really great and then the story was still very good till somewhere around 1000 chapters but after this its 1/10th story 2/10th some extra bull**** And its 7/10th a porno I don't know why the author ****ed up a good story into a porno
2mth
view 0 replies
SpicyAuthor
I think the mc will even **** a dog if he is left alone.. I donno which female character has the mc not ****ed.. He has even ****ed some animals Goooood
2mth
view 0 replies
High_Elf
What the hell happened here😭😡 What the hell happened here😭😡 What the hell happened here😭😡 What the hell happened here😭😡 What the hell happened here😭😡
3mth
view 0 replies
KleinundKnuffig
I really liked this story at the start. The world was interesting, the character description and development was okay and the kingdom developed parts were great. The first few arcs are a good read and if you like kingdom development you can give it a try. But after chapter 1000 or maybe 1100 the quality of the story drops rapidly to the point of nonexistence. The same thing happen over and over again. There is no character description or development anymore, just names and "cold looking", "proud looking", "evil looking" etc. Also the MC seems to drop the last of any morals he had at the start and just does every woman he meets at that point. tldr; Do not read past chapter 1000. Before that the story is okay and has decent Kingdom and World development. After ch. 1000 it's a waste of time and money.
Reveal Spoiler
4mth
view 1 replies
MehmetGeckin
Great Novel 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
Reveal Spoiler
4mth
view 1 replies
MehmetGeckin
Great Novel 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
Reveal Spoiler
4mth
view 0 replies
MehmetGeckin
Great Novel 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
Reveal Spoiler
4mth
view 0 replies
MehmetGeckin
Great novel 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
Reveal Spoiler
4mth
view 0 replies
Halo_ODST10
The more the merrier 😉😉😉😉😉😉😉😉😉😉😉😉😉😉😉😉😉😉😉oh also have fun to others reading 😉😉😉😐😐😐😐😐😐🤔🤔🤔🤔😅😅😅😅😅😅😅😓😓😓😴😴😴
4mth
view 1 replies
ArtieTheGlow
This novel is more or less a **** novel, the author does not care about any morality at all. The MC is licentious, bloodthirsty and just pretty damn evil. He rapes women under the guise of satisfying their sexual urges, he doesn't care about whether the woman is married or not or if she has no feelings for him, as long as she's a beautiful female, he'll bang her. Mother, daughter, aunty, niece, cousin it doesn't matter he'll do them all. The author throws in the whole nonsense that since it's an ancient time novel, all manner of bloodshed is allowed, young, old, man, woman, babies he'll slaughter them all as long as they are not in his authority. So if rape, netorare and senseless bloodshed isn't your thing then don't start reading, the book was good before then it went downhill.
4mth
view 1 replies
next page
Get More Coins

Please switch to the pop-up to complete the payment.

Earn Rewards Earn Rewards

Earn rewards

by completing the missions

Complete daily missions to get rewards.

Learn more about the rules
  • 1. Reward frequency has been adjusted! Receive a reward once you complete two minutes of reading!
  • 2. Rewards adjusted! Earn points reading to exchange for Amazon Gift Cards! Coins that never expire! More rewards to come!(The above rewards are only available on the app.)